PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN26659.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 309aa    MW: 34689.1 Da    PI: 7.5752
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN26659.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.51.8e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd+ lvd+++++G g+W++ +++ g+ R++k+c++rw +yl
       KHN26659.1 14 RGAWTPEEDQALVDYIQKHGHGSWRSLPKHAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding537.8e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE+  +v+++ +lG++ W++Ia+ ++ gRt++++k++w+++l
       KHN26659.1  67 RGPFTSEEESTIVQLHGMLGNR-WASIASQLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-24563IPR009057Homeodomain-like
PROSITE profilePS5129418.295961IPR017930Myb domain
SuperFamilySSF466894.87E-3111108IPR009057Homeodomain-like
SMARTSM007171.4E-141363IPR001005SANT/Myb domain
PfamPF002491.2E-171461IPR001005SANT/Myb domain
CDDcd001676.30E-121661No hitNo description
PROSITE profilePS5129425.21862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-2664116IPR009057Homeodomain-like
SMARTSM007178.5E-1666114IPR001005SANT/Myb domain
PfamPF002493.0E-1567112IPR001005SANT/Myb domain
CDDcd001671.01E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MGKAPCCEKH GVRRGAWTPE EDQALVDYIQ KHGHGSWRSL PKHAGLLRCG KSCRLRWINY  60
LRPGIKRGPF TSEEESTIVQ LHGMLGNRWA SIASQLPGRT DNEIKNFWNT HLKKRLLRSC  120
HSQIAKQLCV IPDQSIVKSE SPSTRHMVQW ESVRVETEAR LSLESTMLNS WPTSKTCPDH  180
FLQLWHSEVG KSFRMIKGKE EGVVSQSLIS QPSSSSKLES CSDVSLQVKT NTGTSSCIPK  240
LEDVSMVHEQ TSSYKPKLDD DTAGSDSGNY EFLDTSDSAL KHLLHMPDSD MGFLGHNDHF  300
QNLLDGTCD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-281411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2352300.0AC235230.1 Glycine max strain Williams 82 clone GM_WBb0026I18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006606110.10.0PREDICTED: myb-related protein 308-like
TrEMBLA0A0B2R3490.0A0A0B2R349_GLYSO; Myb-related protein Myb4
STRINGGLYMA20G29730.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23313280
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.18e-89myb domain protein 17
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]